CYP2D6 Antikörper (Middle Region)
-
- Target Alle CYP2D6 Antikörper anzeigen
- CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CYP2D6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CYP2 D6 antibody was raised against the middle region of CYP2 6
- Aufreinigung
- Affinity purified
- Immunogen
- CYP2 D6 antibody was raised using the middle region of CYP2 6 corresponding to a region with amino acids EAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGV
- Top Product
- Discover our top product CYP2D6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CYP2D6 Blocking Peptide, catalog no. 33R-2258, is also available for use as a blocking control in assays to test for specificity of this CYP2D6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))
- Andere Bezeichnung
- CYP2D6 (CYP2D6 Produkte)
- Synonyme
- CPD6 antikoerper, CYP2D antikoerper, CYP2D7AP antikoerper, CYP2D7BP antikoerper, CYP2D7P2 antikoerper, CYP2D8P2 antikoerper, CYP2DL1 antikoerper, CYPIID6 antikoerper, P450-DB1 antikoerper, P450C2D antikoerper, P450DB1 antikoerper, CYP2D42 antikoerper, MGC64445 antikoerper, cyp2d2 antikoerper, cyp2d6-a antikoerper, CYP2D6 antikoerper, cytochrome P450 family 2 subfamily D member 6 antikoerper, cytochrome P450, family 2, subfamily D, polypeptide 6 antikoerper, cytochrome 2D6 antikoerper, cytochrome P450 family 2 subfamily D member 6 S homeolog antikoerper, cytochrome P450 2D6 antikoerper, cytochrome P450 2D6-like antikoerper, CYP2D6 antikoerper, cyp2d6-b antikoerper, cyp2d6.S antikoerper, cyp2d6 antikoerper, LOC100988273 antikoerper
- Hintergrund
- CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.
- Molekulargewicht
- 56 kDa (MW of target protein)
-