CYP2D6 Antikörper (AA 315-347)

Produktnummer ABIN5647528

Produktdetails anti-CYP2D6 Antikörper

Target: CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))

Bindungsspezifität: AA 315-347

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP2D6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 315-347 (AWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEM) from the human protein were used as the immunogen for the CYP2D6 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the CYP2D6 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the CYP2D6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu CYP2D6

Target: CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))

Andere Bezeichnung: CYP2D6 (CYP2D6 Produkte)

Synonyme: CPD6 antikoerper, CYP2D antikoerper, CYP2D7AP antikoerper, CYP2D7BP antikoerper, CYP2D7P2 antikoerper, CYP2D8P2 antikoerper, CYP2DL1 antikoerper, CYPIID6 antikoerper, P450-DB1 antikoerper, P450C2D antikoerper, P450DB1 antikoerper, CYP2D42 antikoerper, MGC64445 antikoerper, cyp2d2 antikoerper, cyp2d6-a antikoerper, CYP2D6 antikoerper, cytochrome P450 family 2 subfamily D member 6 antikoerper, cytochrome P450, family 2, subfamily D, polypeptide 6 antikoerper, cytochrome 2D6 antikoerper, cytochrome P450 family 2 subfamily D member 6 S homeolog antikoerper, cytochrome P450 2D6 antikoerper, cytochrome P450 2D6-like antikoerper, CYP2D6 antikoerper, cyp2d6-b antikoerper, cyp2d6.S antikoerper, cyp2d6 antikoerper, LOC100988273 antikoerper

Hintergrund: Cytochrome P450 2D6 (CYP2D6) is one of the most important enzymes involved in the metabolism of xenobiotics in the body. It is a member of Cytochrome P450, family 2, subfamily D, polypeptide 6. This gene is mapped to chromosome 22q13.1. It has got 497 amino acid proteins which shares 73 % sequence identity with the rat protein. CYP2D6 is highly expressed in human liver and it is the major isozyme involved in the formation of N-hydroxyprocainamide, a metabolite potentially involved in the drug-induced lupus syndrome observed with procainamide.

UniProt: P10635