SRD5A2 Antikörper (N-Term)
-
- Target Alle SRD5A2 Antikörper anzeigen
- SRD5A2 (Steroid-5-alpha-Reductase, alpha Polypeptide 2 (3-Oxo-5 alpha-Steroid delta 4-Dehydrogenase alpha 2) (SRD5A2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SRD5A2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SRD5 A2 antibody was raised against the N terminal of SRD5 2
- Aufreinigung
- Affinity purified
- Immunogen
- SRD5 A2 antibody was raised using the N terminal of SRD5 2 corresponding to a region with amino acids MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR
- Top Product
- Discover our top product SRD5A2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SRD5A2 Blocking Peptide, catalog no. 33R-6350, is also available for use as a blocking control in assays to test for specificity of this SRD5A2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRD0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SRD5A2 (Steroid-5-alpha-Reductase, alpha Polypeptide 2 (3-Oxo-5 alpha-Steroid delta 4-Dehydrogenase alpha 2) (SRD5A2))
- Andere Bezeichnung
- SRD5A2 (SRD5A2 Produkte)
- Synonyme
- S5AR 2 antikoerper, 5ART2 antikoerper, SRD5alpha2 antikoerper, SRD5A2 antikoerper, Srd5a2 antikoerper, CH73-233A22.6 antikoerper, wu:fk70d02 antikoerper, zgc:109942 antikoerper, zgc:112208 antikoerper, zgc:112455 antikoerper, steroid 5 alpha-reductase 2 antikoerper, steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) antikoerper, 3-oxo-5-alpha-steroid 4-dehydrogenase 2 antikoerper, steroid-5-alpha-reductase, alpha polypeptide 2a antikoerper, steroid-5-alpha-reductase, alpha polypeptide 2b antikoerper, SRD5A2 antikoerper, Srd5a2 antikoerper, srd5a2 antikoerper, LOC100125532 antikoerper, srd5a2a antikoerper, srd5a2b antikoerper
- Hintergrund
- This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride.
- Molekulargewicht
- 28 kDa (MW of target protein)
- Pathways
- Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis
-