ACVR1 Antikörper (N-Term)
-
- Target Alle ACVR1 (ACRV1) Antikörper anzeigen
- ACVR1 (ACRV1) (Activin Receptor Type I (ACRV1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACVR1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ACVR1 antibody was raised against the N terminal of ACVR1
- Aufreinigung
- Affinity purified
- Immunogen
- ACVR1 antibody was raised using the N terminal of ACVR1 corresponding to a region with amino acids EGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSP
- Top Product
- Discover our top product ACRV1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACVR1 Blocking Peptide, catalog no. 33R-2439, is also available for use as a blocking control in assays to test for specificity of this ACVR1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACVR1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACVR1 (ACRV1) (Activin Receptor Type I (ACRV1))
- Andere Bezeichnung
- ACVR1 (ACRV1 Produkte)
- Synonyme
- ACTRI antikoerper, ACVR1A antikoerper, ACVRLK2 antikoerper, ALK2 antikoerper, FOP antikoerper, SKR1 antikoerper, TSRI antikoerper, ActR-IA antikoerper, ActR-I antikoerper, ActRIA antikoerper, Acvr antikoerper, Acvrlk2 antikoerper, Alk-2 antikoerper, Alk8 antikoerper, D330013D15Rik antikoerper, Tsk7L antikoerper, actri antikoerper, acvr1 antikoerper, acvr1-a antikoerper, acvr1-b antikoerper, acvr1a antikoerper, acvrlk2 antikoerper, alk-2 antikoerper, alk2 antikoerper, alk8 antikoerper, fop antikoerper, sax antikoerper, skr1 antikoerper, tsri antikoerper, xALK-2 antikoerper, activin A receptor type 1 antikoerper, activin A receptor, type 1 antikoerper, activin A receptor type 1 S homeolog antikoerper, ACVR1 antikoerper, Acvr1 antikoerper, acvr1.S antikoerper
- Hintergrund
- Activin receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. ACVR1 is activin A type I receptor which signals a particular transcriptional response in concert with activin type II receptors.
- Molekulargewicht
- 55 kDa (MW of target protein)
-