PTPRE Antikörper (Middle Region)

Produktnummer ABIN635886

Produktdetails anti-PTPRE Antikörper

Target: PTPRE (Protein tyrosine Phosphatase, Receptor Type, E (PTPRE))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTPRE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PTPRE antibody was raised against the middle region of PTPRE

Aufreinigung: Affinity purified

Immunogen: PTPRE antibody was raised using the middle region of PTPRE corresponding to a region with amino acids VILSMKRGQEYTDYINASFIDGYRQKDYFIATQGPLAHTVEDFWRMIWEW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PTPRE Blocking Peptide, catalog no. 33R-9603, is also available for use as a blocking control in assays to test for specificity of this PTPRE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTPRE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PTPRE

Target: PTPRE (Protein tyrosine Phosphatase, Receptor Type, E (PTPRE))

Andere Bezeichnung: PTPRE (PTPRE Produkte)

Synonyme: ptpra antikoerper, HPTPE antikoerper, PTPE antikoerper, R-PTP-EPSILON antikoerper, PTPe antikoerper, PTPepsilon antikoerper, RPTPepsilon antikoerper, protein tyrosine phosphatase, receptor type E L homeolog antikoerper, protein tyrosine phosphatase, receptor type E antikoerper, protein tyrosine phosphatase, receptor type, E antikoerper, ptpre.L antikoerper, PTPRE antikoerper, Ptpre antikoerper

Hintergrund: PTPRE is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. Two alternatively spliced transcript variants of this gene have been reported, one of which encodes a receptor-type PTP that possesses a short extracellular domain, a single transmembrane region, and two tandem intracytoplasmic catalytic domains.

Molekulargewicht: 81 kDa (MW of target protein)