PSMA Antikörper

Produktnummer ABIN635723

Produktdetails anti-PSMA Antikörper

Target: PSMA (FOLH1) (Folate Hydrolase (Prostate-Specific Membrane Antigen) 1 (FOLH1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSMA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: FOLH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FOLH1 Blocking Peptide, catalog no. 33R-3141, is also available for use as a blocking control in assays to test for specificity of this FOLH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FOLH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PSMA

Target: PSMA (FOLH1) (Folate Hydrolase (Prostate-Specific Membrane Antigen) 1 (FOLH1))

Andere Bezeichnung: FOLH1 (FOLH1 Produkte)

Synonyme: FGCP antikoerper, FOLH antikoerper, GCP2 antikoerper, GCPII antikoerper, NAALAD1 antikoerper, NAALAdase antikoerper, PSM antikoerper, PSMA antikoerper, mGCP antikoerper, mopsm antikoerper, Naalad antikoerper, putative N-acetylated-alpha-linked acidic dipeptidase antikoerper, folate hydrolase 1B antikoerper, folate hydrolase 1 antikoerper, folate hydrolase (prostate-specific membrane antigen) 1 antikoerper, LOC451185 antikoerper, FOLH1B antikoerper, FOLH1 antikoerper, Folh1 antikoerper

Hintergrund: FOLH1 is a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity.

Molekulargewicht: 84 kDa (MW of target protein)