NTRK3 Antikörper (C-Term)

Produktnummer ABIN635695

Produktdetails anti-NTRK3 Antikörper

Target: NTRK3 (Neurotrophic tyrosine Kinase, Receptor, Type 3 (NTRK3))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NTRK3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NTRK3 antibody was raised against the C terminal of NTRK3

Aufreinigung: Affinity purified

Immunogen: NTRK3 antibody was raised using the C terminal of NTRK3 corresponding to a region with amino acids ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NTRK3 Blocking Peptide, catalog no. 33R-2709, is also available for use as a blocking control in assays to test for specificity of this NTRK3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NTRK3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NTRK3

Target: NTRK3 (Neurotrophic tyrosine Kinase, Receptor, Type 3 (NTRK3))

Andere Bezeichnung: NTRK3 (NTRK3 Produkte)

Synonyme: TRKC antikoerper, gp145(trkC) antikoerper, trkC antikoerper, AW125844 antikoerper, Ntrk3_tv3 antikoerper, TrkC antikoerper, neurotrophic receptor tyrosine kinase 3 antikoerper, neurotrophic tyrosine kinase, receptor, type 3 antikoerper, NTRK3 antikoerper, Ntrk3 antikoerper

Hintergrund: NTRK3 is a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers.

Molekulargewicht: 89 kDa (MW of target protein)

Pathways: RTK Signalweg, Neurotrophin Signalübertragung, Regulation of Cell Size