SLC22A17 Antikörper (Middle Region)

Produktnummer ABIN635375

Produktdetails anti-SLC22A17 Antikörper

Target: SLC22A17 (Solute Carrier Family 22 (Organic Cation Transporter), Member 17 (SLC22A17))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC22A17 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC22 A17 antibody was raised against the middle region of SLC22 17

Aufreinigung: Affinity purified

Immunogen: SLC22 A17 antibody was raised using the middle region of SLC22 17 corresponding to a region with amino acids HCYQPVGGGGSPSDFYLCSLLASGTAALACVFLGVTVDRFGRRGILLLSM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC22A17 Blocking Peptide, catalog no. 33R-3704, is also available for use as a blocking control in assays to test for specificity of this SLC22A17 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 17 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC22A17

Target: SLC22A17 (Solute Carrier Family 22 (Organic Cation Transporter), Member 17 (SLC22A17))

Andere Bezeichnung: SLC22A17 (SLC22A17 Produkte)

Synonyme: 1700094C23Rik antikoerper, 24p3R antikoerper, AU041908 antikoerper, AW555662 antikoerper, BOIT antikoerper, Boct antikoerper, mBOCT antikoerper, BOCT antikoerper, NGALR antikoerper, NGALR2 antikoerper, NGALR3 antikoerper, hBOIT antikoerper, rBOCT antikoerper, solute carrier family 22 member 17 antikoerper, solute carrier family 22 (organic cation transporter), member 17 antikoerper, solute carrier family 22, member 17 antikoerper, SLC22A17 antikoerper, Slc22a17 antikoerper

Hintergrund: The function of SLC22A17 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 58 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis