CCDC90A Antikörper (Middle Region)
-
- Target Alle CCDC90A (MCUR1) Antikörper anzeigen
- CCDC90A (MCUR1) (Mitochondrial Calcium Uniporter Regulator 1 (MCUR1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CCDC90A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CCDC90 A antibody was raised against the middle region of CCDC90
- Aufreinigung
- Affinity purified
- Immunogen
- CCDC90 A antibody was raised using the middle region of CCDC90 corresponding to a region with amino acids ELHQLKQQVMDEVIKVRTDTKLDFNLEKSRVKELYSLNEKKLLELRTEIV
- Top Product
- Discover our top product MCUR1 Primärantikörper
-
anti-Mitochondrial Calcium Uniporter Regulator 1 (MCUR1) (Middle Region) antibody
MCUR1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Meerschweinchen WB Wirt: Kaninchen Polyclonal unconjugated
anti-Mitochondrial Calcium Uniporter Regulator 1 (MCUR1) (AA 252-301) antibodyMCUR1 Reaktivität: Human, Rind (Kuh), Hund, Pferd, Affe WB, IHC (p), IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Mitochondrial Calcium Uniporter Regulator 1 (MCUR1) (AA 261-359) antibodyMCUR1 Reaktivität: Human IF (cc), IF (p), ELISA, IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CCDC90A Blocking Peptide, catalog no. 33R-2548, is also available for use as a blocking control in assays to test for specificity of this CCDC90A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC90 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CCDC90A (MCUR1) (Mitochondrial Calcium Uniporter Regulator 1 (MCUR1))
- Andere Bezeichnung
- CCDC90A (MCUR1 Produkte)
- Synonyme
- C6orf79 antikoerper, CCDC90A antikoerper, 6230416A05Rik antikoerper, AU015498 antikoerper, AV136929 antikoerper, AW554392 antikoerper, C88263 antikoerper, Ccdc90a antikoerper, RGD1307673 antikoerper, mitochondrial calcium uniporter regulator 1 antikoerper, mitochondrial calcium uniporter regulator 1 L homeolog antikoerper, MCUR1 antikoerper, Mcur1 antikoerper, mcur1.L antikoerper
- Hintergrund
- The function of CCDC90A protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 40 kDa (MW of target protein)
-
