SLC39A4 Antikörper

Produktnummer ABIN635269

Produktdetails anti-SLC39A4 Antikörper

Target: SLC39A4 (Solute Carrier Family 39 (Zinc Transporter), Member 4 (SLC39A4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC39A4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC39 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLGLHTHSEEGLSPQPTWRLLAMLAGLYAFFLFENLFNLLLPRDPEDLED

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC39A4 Blocking Peptide, catalog no. 33R-9661, is also available for use as a blocking control in assays to test for specificity of this SLC39A4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC39A4

Target: SLC39A4 (Solute Carrier Family 39 (Zinc Transporter), Member 4 (SLC39A4))

Andere Bezeichnung: SLC39A4 (SLC39A4 Produkte)

Synonyme: AEZ antikoerper, AWMS2 antikoerper, ZIP4 antikoerper, 1600025H15Rik antikoerper, AU041686 antikoerper, solute carrier family 39 member 4 antikoerper, solute carrier family 39 (zinc transporter), member 4 antikoerper, SLC39A4 antikoerper, slc39a4 antikoerper, Slc39a4 antikoerper

Hintergrund: SLC39A4 is a member of the zinc/iron-regulated transporter-like protein (ZIP) family. The transmembrane protein is required for zinc uptake in the intestine. Mutations in the gene encoding SLC39A4 result in acrodermatitis enteropathica, a rare inherited defect in the absorption of dietary zinc.

Molekulargewicht: 66 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Autophagie