SLC39A4 Antikörper
-
- Target Alle SLC39A4 Antikörper anzeigen
- SLC39A4 (Solute Carrier Family 39 (Zinc Transporter), Member 4 (SLC39A4))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC39A4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC39 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLGLHTHSEEGLSPQPTWRLLAMLAGLYAFFLFENLFNLLLPRDPEDLED
- Top Product
- Discover our top product SLC39A4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC39A4 Blocking Peptide, catalog no. 33R-9661, is also available for use as a blocking control in assays to test for specificity of this SLC39A4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC39A4 (Solute Carrier Family 39 (Zinc Transporter), Member 4 (SLC39A4))
- Andere Bezeichnung
- SLC39A4 (SLC39A4 Produkte)
- Synonyme
- AEZ antikoerper, AWMS2 antikoerper, ZIP4 antikoerper, 1600025H15Rik antikoerper, AU041686 antikoerper, solute carrier family 39 member 4 antikoerper, solute carrier family 39 (zinc transporter), member 4 antikoerper, SLC39A4 antikoerper, slc39a4 antikoerper, Slc39a4 antikoerper
- Hintergrund
- SLC39A4 is a member of the zinc/iron-regulated transporter-like protein (ZIP) family. The transmembrane protein is required for zinc uptake in the intestine. Mutations in the gene encoding SLC39A4 result in acrodermatitis enteropathica, a rare inherited defect in the absorption of dietary zinc.
- Molekulargewicht
- 66 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis, Autophagie
-