SPTLC1 Antikörper (Middle Region)

Produktnummer ABIN635128

Produktdetails anti-SPTLC1 Antikörper

Target: SPTLC1 (serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPTLC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SPTLC1 antibody was raised against the middle region of SPTLC1

Aufreinigung: Affinity purified

Immunogen: SPTLC1 antibody was raised using the middle region of SPTLC1 corresponding to a region with amino acids DLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SPTLC1 Blocking Peptide, catalog no. 33R-2041, is also available for use as a blocking control in assays to test for specificity of this SPTLC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPTLC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SPTLC1

Target: SPTLC1 (serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1))

Andere Bezeichnung: SPTLC1 (SPTLC1 Produkte)

Synonyme: ATSPT1 antikoerper, SERINE PALMITOYLTRANSFERASE 1 antikoerper, serine palmitoyltransferase 1 antikoerper, Afu6g00300 antikoerper, HSAN1 antikoerper, HSN1 antikoerper, LBC1 antikoerper, LCB1 antikoerper, SPT1 antikoerper, SPTI antikoerper, wu:fc75h04 antikoerper, wu:fp41c08 antikoerper, zgc:112247 antikoerper, AW552086 antikoerper, C77762 antikoerper, E030036H05 antikoerper, Lcb1 antikoerper, RGD1306617 antikoerper, Spt1 antikoerper, serine palmitoyltransferase 1 antikoerper, Serine palmitoyltransferase 1 antikoerper, serine palmitoyltransferase long chain base subunit 1 antikoerper, serine palmitoyltransferase, long chain base subunit 1 antikoerper, serine palmitoyltransferase, long chain base subunit 1 L homeolog antikoerper, SPT1 antikoerper, AFUA_6G00300 antikoerper, PAS_FragB_0040 antikoerper, SPTLC1 antikoerper, sptlc1 antikoerper, sptlc1.L antikoerper, Sptlc1 antikoerper

Hintergrund: Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate as a cofactor. SPTLC1 is the long chain base subunit 1 of serine palmitoyltransferase. Mutations in SPTLC1 gene were identified in patients with hereditary sensory neuropathy type 1.

Molekulargewicht: 53 kDa (MW of target protein)