LIF Antikörper

Produktnummer ABIN634803

Produktdetails anti-LIF Antikörper

Target: LIF (Leukemia Inhibitory Factor (LIF))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LIF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: LIF antibody was raised using a synthetic peptide corresponding to a region with amino acids KVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LIF Blocking Peptide, catalog no. 33R-4712, is also available for use as a blocking control in assays to test for specificity of this LIF antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIF antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LIF

Target: LIF (Leukemia Inhibitory Factor (LIF))

Andere Bezeichnung: LIF (LIF Produkte)

Synonyme: CDF antikoerper, DIA antikoerper, HILDA antikoerper, MLPLI antikoerper, LIF, interleukin 6 family cytokine antikoerper, leukemia inhibitory factor antikoerper, LIF antikoerper, Lif antikoerper

Hintergrund: LIF is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface.

Molekulargewicht: 22 kDa (MW of target protein)

Pathways: JAK-STAT Signalweg, Positive Regulation of Peptide Hormone Secretion, Negative Regulation of Hormone Secretion, Stem Cell Maintenance, Growth Factor Binding