GDF15 Antikörper (N-Term)
-
- Target Alle GDF15 Antikörper anzeigen
- GDF15 (Growth Differentiation Factor 15 (GDF15))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GDF15 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GDF15 antibody was raised against the N terminal of GDF15
- Aufreinigung
- Affinity purified
- Immunogen
- GDF15 antibody was raised using the N terminal of GDF15 corresponding to a region with amino acids ASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAP
- Top Product
- Discover our top product GDF15 Primärantikörper
-
anti-Growth Differentiation Factor 15 (GDF15) (AA 49-308) antibody
GDF15 Reaktivität: Human WB, IHC, IP, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Growth Differentiation Factor 15 (GDF15) (C-Term) antibodyVerified GDF15 Reaktivität: Human WB, ELISA, IHC, FACS Wirt: Ziege Polyclonal unconjugated
anti-Growth Differentiation Factor 15 (GDF15) (C-Term) antibody (Biotin)GDF15 Reaktivität: Human, Maus WB, ELISA Wirt: Kaninchen Polyclonal Biotin
anti-Growth Differentiation Factor 15 (GDF15) (AA 51-79) antibodyGDF15 Reaktivität: Human WB, ELISA, IHC, FACS Wirt: Kaninchen Polyclonal unconjugated
anti-Growth Differentiation Factor 15 (GDF15) (AA 30-308) antibodyGDF15 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Growth Differentiation Factor 15 (GDF15) (AA 221-308) antibodyGDF15 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC (p), IF (cc), IF (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Growth Differentiation Factor 15 (GDF15) (AA 51-79), (N-Term) antibodyGDF15 Reaktivität: Human WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB30209 unconjugated
anti-Growth Differentiation Factor 15 (GDF15) (C-Term) antibody (HRP)GDF15 Reaktivität: Human, Maus WB, ELISA Wirt: Kaninchen Polyclonal HRP
anti-Growth Differentiation Factor 15 (GDF15) (AA 195-308) antibodyGDF15 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Growth Differentiation Factor 15 (GDF15) (AA 198-308) antibodyGDF15 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GDF15 Blocking Peptide, catalog no. 33R-1525, is also available for use as a blocking control in assays to test for specificity of this GDF15 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GDF15 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GDF15 (Growth Differentiation Factor 15 (GDF15))
- Andere Bezeichnung
- GDF15 (GDF15 Produkte)
- Synonyme
- GDF15 antikoerper, GDF-15 antikoerper, MIC-1 antikoerper, MIC1 antikoerper, NAG-1 antikoerper, PDF antikoerper, PLAB antikoerper, PTGFB antikoerper, SBF antikoerper, growth differentiation factor 15 antikoerper, GDF15 antikoerper, Gdf15 antikoerper
- Hintergrund
- Bone morphogenetic proteins are members of the transforming growth factor-beta superfamily and regulate tissue differentiation and maintenance.
- Molekulargewicht
- 34 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-
