Mesothelin Antikörper (Middle Region)
-
- Target Alle Mesothelin (MSLN) Antikörper anzeigen
- Mesothelin (MSLN)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Mesothelin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Mesothelin antibody was raised against the middle region of MSLN
- Aufreinigung
- Affinity purified
- Immunogen
- Mesothelin antibody was raised using the middle region of MSLN corresponding to a region with amino acids QKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVL
- Top Product
- Discover our top product MSLN Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Mesothelin Blocking Peptide, catalog no. 33R-7609, is also available for use as a blocking control in assays to test for specificity of this Mesothelin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSLN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Mesothelin (MSLN)
- Andere Bezeichnung
- Mesothelin (MSLN Produkte)
- Synonyme
- MPF antikoerper, SMRP antikoerper, MSLN antikoerper, mesothelin antikoerper, MSLN antikoerper, Msln antikoerper, LOC611363 antikoerper, LOC100524016 antikoerper
- Hintergrund
- An antibody that reacts with ovarian cancers and mesotheliomas was used to isolate a cell surface antigen named mesothelin. Although the function of mesothelin is unknown, it may play a role in cellular adhesion and is present on mesothelium, mesotheliomas, and ovarian cancers.
- Molekulargewicht
- 32 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway, Positive Regulation of Peptide Hormone Secretion, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Carbohydrate Homeostasis, cAMP Metabolic Process, Regulation of G-Protein Coupled Receptor Protein Signaling, Positive Regulation of Endopeptidase Activity, Regulation of Carbohydrate Metabolic Process
-