GJB1 Antikörper (Middle Region)
-
- Target Alle GJB1 Antikörper anzeigen
- GJB1 (Gap Junction Protein, beta 1, 32kDa (GJB1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GJB1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GJB1 antibody was raised against the middle region of GJB1
- Aufreinigung
- Affinity purified
- Immunogen
- GJB1 antibody was raised using the middle region of GJB1 corresponding to a region with amino acids RACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILR
- Top Product
- Discover our top product GJB1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GJB1 Blocking Peptide, catalog no. 33R-7802, is also available for use as a blocking control in assays to test for specificity of this GJB1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJB1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GJB1 (Gap Junction Protein, beta 1, 32kDa (GJB1))
- Andere Bezeichnung
- GJB1 (GJB1 Produkte)
- Synonyme
- GJIC antikoerper, cmtx antikoerper, cmtx1 antikoerper, connexin-30 antikoerper, connexin32 antikoerper, cx30 antikoerper, cx32 antikoerper, gja1 antikoerper, CX32 antikoerper, GJB1 antikoerper, AI118175 antikoerper, Cnx32 antikoerper, Cx32 antikoerper, Gjb-1 antikoerper, CMTX antikoerper, CMTX1 antikoerper, gjb1-a antikoerper, gap junction protein beta 1 antikoerper, connexin 32 antikoerper, probable serine/threonine-protein kinase CST antikoerper, gap junction protein, beta 1 antikoerper, gap junction protein beta 1 L homeolog antikoerper, gjb1 antikoerper, CX32 antikoerper, LOC9303136 antikoerper, GJB1 antikoerper, Gjb1 antikoerper, gjb1.L antikoerper
- Hintergrund
- This gene encodes a member of the gap junction protein family. The gap junction proteins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells.
- Molekulargewicht
- 32 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-