Fibronectin 1 Antikörper (N-Term)
-
- Target Alle Fibronectin 1 (FN1) Antikörper anzeigen
- Fibronectin 1 (FN1)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Fibronectin 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Fibronectin 1 antibody was raised against the N terminal of FN1
- Aufreinigung
- Affinity purified
- Immunogen
- Fibronectin 1 antibody was raised using the N terminal of FN1 corresponding to a region with amino acids GNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
- Top Product
- Discover our top product FN1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Fibronectin 1 Blocking Peptide, catalog no. 33R-3443, is also available for use as a blocking control in assays to test for specificity of this Fibronectin 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FN1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Fibronectin 1 (FN1)
- Andere Bezeichnung
- Fibronectin 1 (FN1 Produkte)
- Synonyme
- FN1 antikoerper, FN antikoerper, cig antikoerper, fibronectin antikoerper, finc antikoerper, lets antikoerper, msf antikoerper, Fn antikoerper, fn2 antikoerper, fb80d10 antikoerper, wu:fb80d10 antikoerper, CIG antikoerper, ED-B antikoerper, FINC antikoerper, FNZ antikoerper, GFND antikoerper, GFND2 antikoerper, LETS antikoerper, MSF antikoerper, E330027I09 antikoerper, Fn-1 antikoerper, FIBNEC antikoerper, fn-1 antikoerper, fibronectin 1 antikoerper, fibronectin 1a antikoerper, fibronectin 1 S homeolog antikoerper, FN1 antikoerper, fn1 antikoerper, fn1a antikoerper, Fn1 antikoerper, fn1.S antikoerper
- Hintergrund
- FN1 is a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis and wound healing.
- Molekulargewicht
- 71 kDa (MW of target protein)
- Pathways
- Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Autophagie
-