MAPT Antikörper (Middle Region)

Produktnummer ABIN634593

Produktdetails anti-MAPT Antikörper

Target: MAPT (Microtubule-Associated Protein tau (MAPT))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAPT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAPT antibody was raised against the middle region of MAPT

Aufreinigung: Affinity purified

Immunogen: MAPT antibody was raised using the middle region of MAPT corresponding to a region with amino acids NAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLAD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAPT Blocking Peptide, catalog no. 33R-6638, is also available for use as a blocking control in assays to test for specificity of this MAPT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAPT

Target: MAPT (Microtubule-Associated Protein tau (MAPT))

Andere Bezeichnung: MAPT (MAPT Produkte)

Synonyme: DDPAC antikoerper, FTDP-17 antikoerper, MAPTL antikoerper, MSTD antikoerper, MTBT1 antikoerper, MTBT2 antikoerper, PPND antikoerper, TAU antikoerper, AI413597 antikoerper, AW045860 antikoerper, Mtapt antikoerper, Tau antikoerper, RNPTAU antikoerper, pTau antikoerper, tau antikoerper, xtp antikoerper, MAPT antikoerper, PHF-tau antikoerper, slc6a6 antikoerper, taut antikoerper, wu:fc26e12 antikoerper, microtubule associated protein tau antikoerper, microtubule-associated protein tau antikoerper, microtubule associated protein tau S homeolog antikoerper, Microtubule-associated protein tau antikoerper, solute carrier family 6 (neurotransmitter transporter), member 6b antikoerper, MAPT antikoerper, Mapt antikoerper, mapt.S antikoerper, LOC5580230 antikoerper, CpipJ_CPIJ013260 antikoerper, tau antikoerper, slc6a6b antikoerper

Hintergrund: MAPT is differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. The mutations in the gene have been associated with several neurodegenerative disorders such as Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: MAPK Signalweg, Microtubule Dynamics, M Phase, Regulation of Cell Size