ATP6V0A2 Antikörper (N-Term)

Produktnummer ABIN634572

Produktdetails anti-ATP6V0A2 Antikörper

Target: ATP6V0A2 (ATPase, H+ Transporting, Lysosomal V0 Subunit A2 (ATP6V0A2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP6V0A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ATP6 V6 2 antibody was raised against the N terminal of ATP6 6 2

Aufreinigung: Affinity purified

Immunogen: ATP6 V6 2 antibody was raised using the N terminal of ATP6 6 2 corresponding to a region with amino acids INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATP6V0A2 Blocking Peptide, catalog no. 33R-4080, is also available for use as a blocking control in assays to test for specificity of this ATP6V0A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATP6V0A2

Target: ATP6V0A2 (ATPase, H+ Transporting, Lysosomal V0 Subunit A2 (ATP6V0A2))

Andere Bezeichnung: ATP6V0A2 (ATP6V0A2 Produkte)

Synonyme: A2 antikoerper, ARCL antikoerper, ARCL2A antikoerper, ATP6A2 antikoerper, ATP6N1D antikoerper, J6B7 antikoerper, RTF antikoerper, STV1 antikoerper, TJ6 antikoerper, TJ6M antikoerper, TJ6S antikoerper, VPH1 antikoerper, WSS antikoerper, 8430408C20Rik antikoerper, AI385560 antikoerper, ATP6a2 antikoerper, AW489264 antikoerper, Atp6n1d antikoerper, Atp6n2 antikoerper, C76904 antikoerper, ISF antikoerper, SHIF antikoerper, Stv1 antikoerper, TJ6s antikoerper, Tj6 antikoerper, V-ATPase 116 kDa antikoerper, V-ATPase a2 antikoerper, Cc1-3 antikoerper, J6b7 antikoerper, atp6v0a2 antikoerper, si:ch211-199i18.4 antikoerper, si:ch211-106a19.2 antikoerper, ATPase H+ transporting V0 subunit a2 antikoerper, ATPase, H+ transporting, lysosomal V0 subunit A2 antikoerper, ATPase, H+ transporting, lysosomal V0 subunit a2a antikoerper, ATPase, H+ transporting, lysosomal V0 subunit a2b antikoerper, ATP6V0A2 antikoerper, Atp6v0a2 antikoerper, atp6v0a2a antikoerper, atp6v0a2b antikoerper

Hintergrund: The multisubunit vacuolar-type proton pump (H(+)-ATPase or V-ATPase) is essential for acidification of diverse cellular components, including endosomes, lysosomes, clathrin-coated vesicles, secretory vesicles, and chromaffin granules, and it is found at high density in the plasma membrane of certain specialized cells.

Molekulargewicht: 98 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Proton Transport