RHEB Antikörper (Middle Region)

Produktnummer ABIN634367

Produktdetails anti-RHEB Antikörper

Target: RHEB (Ras Homolog Enriched in Brain (RHEB))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RHEB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RHEB antibody was raised against the middle region of RHEB

Aufreinigung: Affinity purified

Immunogen: RHEB antibody was raised using the middle region of RHEB corresponding to a region with amino acids VGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RHEB Blocking Peptide, catalog no. 33R-9564, is also available for use as a blocking control in assays to test for specificity of this RHEB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHEB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RHEB

Target: RHEB (Ras Homolog Enriched in Brain (RHEB))

Andere Bezeichnung: RHEB (RHEB Produkte)

Synonyme: RHEB2 antikoerper, RHEB antikoerper, rheb2 antikoerper, CG1081 antikoerper, DReb antikoerper, Dm Rheb antikoerper, DmRheb antikoerper, Dmel\CG1081 antikoerper, Q9VND8 antikoerper, RheB antikoerper, dRheb antikoerper, rheb antikoerper, Ras homolog, mTORC1 binding antikoerper, Ras homolog enriched in brain antikoerper, ras homolog enriched in brain antikoerper, Ras homolog, mTORC1 binding L homeolog antikoerper, RHEB antikoerper, Rheb antikoerper, rheb antikoerper, rheb.L antikoerper

Hintergrund: This gene is a member of the small GTPase superfamily and encodes a lipid-anchored, cell membrane protein with five repeats of the RAS-related GTP-binding region.

Molekulargewicht: 20 kDa (MW of target protein)

Pathways: RTK Signalweg