RAB27A Antikörper (Middle Region)
-
- Target Alle RAB27A Antikörper anzeigen
- RAB27A (RAB27A, Member RAS Oncogene Family (RAB27A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RAB27A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RAB27 A antibody was raised against the middle region of RAB27
- Aufreinigung
- Affinity purified
- Immunogen
- RAB27 A antibody was raised using the middle region of RAB27 corresponding to a region with amino acids SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG
- Top Product
- Discover our top product RAB27A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RAB27A Blocking Peptide, catalog no. 33R-8704, is also available for use as a blocking control in assays to test for specificity of this RAB27A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB20 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAB27A (RAB27A, Member RAS Oncogene Family (RAB27A))
- Andere Bezeichnung
- RAB27A (RAB27A Produkte)
- Synonyme
- MGC80943 antikoerper, RAB27A antikoerper, gs2 antikoerper, ram antikoerper, rab27 antikoerper, MGC89827 antikoerper, hst18676 antikoerper, zgc:114135 antikoerper, GS2 antikoerper, HsT18676 antikoerper, RAB27 antikoerper, RAM antikoerper, 2210402C08Rik antikoerper, 2410003M20Rik antikoerper, 4933437C11Rik antikoerper, ash antikoerper, RAB27A, member RAS oncogene family L homeolog antikoerper, RAB27A, member RAS oncogene family antikoerper, RAB27A, member RAS oncogene family S homeolog antikoerper, rab27a.L antikoerper, RAB27A antikoerper, rab27a antikoerper, rab27a.S antikoerper, Rab27a antikoerper
- Hintergrund
- The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction.
- Molekulargewicht
- 25 kDa (MW of target protein)
- Pathways
- Peptide Hormone Metabolism
-