COL4a3 Antikörper

Produktnummer ABIN634306

Produktdetails anti-COL4a3 Antikörper

Target: COL4a3 (COL4A3) (Collagen, Type IV, alpha 3 (COL4A3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser COL4a3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Collagen Type IV alpha 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Collagen Type IV alpha 3 Blocking Peptide, catalog no. 33R-7287, is also available for use as a blocking control in assays to test for specificity of this Collagen Type IV alpha 3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COL0 0 P antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu COL4a3

Target: COL4a3 (COL4A3) (Collagen, Type IV, alpha 3 (COL4A3))

Andere Bezeichnung: Collagen Type IV alpha 3 (COL4A3 Produkte)

Synonyme: zTumstatin antikoerper, [a]3(IV) antikoerper, alpha3(IV) antikoerper, collagen type IV alpha 3 chain antikoerper, collagen, type IV, alpha 3 antikoerper, COL4A3 antikoerper, col4a3 antikoerper, Col4a3 antikoerper

Hintergrund: This gene encodes a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen. Goodpasture disease is the result of an autoimmune response directed at this antigen. One isoform of this protein is also involved in ceramide intracellular transport. Two transcripts exist for this gene.

Molekulargewicht: 68 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Positive Regulation of Endopeptidase Activity