ECT2 Antikörper (Middle Region)

Produktnummer ABIN634287

Produktdetails anti-ECT2 Antikörper

Target: ECT2 (Epithelial Cell Transforming Sequence 2 Oncogene (ECT2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ECT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ECT2 antibody was raised against the middle region of ECT2

Aufreinigung: Affinity purified

Immunogen: ECT2 antibody was raised using the middle region of ECT2 corresponding to a region with amino acids KKHTADENPDKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ECT2 Blocking Peptide, catalog no. 33R-4471, is also available for use as a blocking control in assays to test for specificity of this ECT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ECT2

Target: ECT2 (Epithelial Cell Transforming Sequence 2 Oncogene (ECT2))

Andere Bezeichnung: ECT2 (ECT2 Produkte)

Synonyme: ECT2 antikoerper, arhgef31 antikoerper, xect2 antikoerper, AI528536 antikoerper, mKIAA4037 antikoerper, ARHGEF31 antikoerper, ect2 antikoerper, epithelial cell transforming 2 antikoerper, ect2 oncogene antikoerper, epithelial cell transforming 2 S homeolog antikoerper, ECT2 antikoerper, ect2 antikoerper, Ect2 antikoerper, ect2.S antikoerper

Hintergrund: ECT2 is a transforming protein that is related to Rho-specific exchange factors and yeast cell cycle regulators. The expression of ECT2 is elevated with the onset of DNA synthesis and remains elevated during G2 and M phases. In situ hybridization analysis showed that expression is at a high level in cells undergoing mitosis in regenerating liver. Thus, this protein is expressed in a cell cycle-dependent manner during liver regeneration, and is thought to have an important role in the regulation of cytokinesis.

Molekulargewicht: 100 kDa (MW of target protein)

Pathways: Neurotrophin Signalübertragung, Cell-Cell Junction Organization