KHDRBS1 Antikörper (N-Term)
-
- Target Alle KHDRBS1 Antikörper anzeigen
- KHDRBS1 (KH Domain Containing, RNA Binding, Signal Transduction Associated 1 (KHDRBS1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KHDRBS1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KHDRBS1 antibody was raised against the N terminal of KHDRBS1
- Aufreinigung
- Affinity purified
- Immunogen
- KHDRBS1 antibody was raised using the N terminal of KHDRBS1 corresponding to a region with amino acids LPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKN
- Top Product
- Discover our top product KHDRBS1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KHDRBS1 Blocking Peptide, catalog no. 33R-5263, is also available for use as a blocking control in assays to test for specificity of this KHDRBS1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHDRBS1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KHDRBS1 (KH Domain Containing, RNA Binding, Signal Transduction Associated 1 (KHDRBS1))
- Andere Bezeichnung
- KHDRBS1 (KHDRBS1 Produkte)
- Synonyme
- Sam68 antikoerper, p62 antikoerper, p68 antikoerper, fj90g10 antikoerper, khdrbs1 antikoerper, wu:fa18g12 antikoerper, wu:fa56c01 antikoerper, wu:fc91b01 antikoerper, wu:fj90g10 antikoerper, zgc:113899 antikoerper, KHDRBS1 antikoerper, P62 antikoerper, khdrbs1l antikoerper, sb:cb97 antikoerper, wu:fb07d11 antikoerper, wu:fi43c05 antikoerper, zgc:85948 antikoerper, KH RNA binding domain containing, signal transduction associated 1 antikoerper, KH domain containing, RNA binding, signal transduction associated 1a antikoerper, KH domain containing, RNA binding, signal transduction associated 1 antikoerper, KH domain containing, RNA binding, signal transduction associated 1 S homeolog antikoerper, KH domain containing, RNA binding, signal transduction associated 1b antikoerper, KHDRBS1 antikoerper, khdrbs1a antikoerper, khdrbs1 antikoerper, Khdrbs1 antikoerper, khdrbs1.S antikoerper, khdrbs1b antikoerper
- Hintergrund
- KHDRBS1 recruited and tyrosine phosphorylated by several receptor systems, for example the T-cell, leptin and insulin receptors. Once phosphorylated, KHDRBS1 functions as an adapter protein in signal transduction cascades by binding to SH2 and SH3 domain-containing proteins. KHDRBS1 play a role in G2-M progression in the cell cycle. It represses CBP-dependent transcriptional activation apparently by competing with other nuclear factors for binding to CBP. KHDRBS1 also acts as a putative regulator of mRNA stability and/or translation rates and mediates mRNA nuclear export.
- Molekulargewicht
- 48 kDa (MW of target protein)
- Pathways
- NF-kappaB Signalweg, Neurotrophin Signalübertragung, Autophagie
-