KHDRBS1 Antikörper (N-Term)

Produktnummer ABIN634247

Produktdetails anti-KHDRBS1 Antikörper

Target: KHDRBS1 (KH Domain Containing, RNA Binding, Signal Transduction Associated 1 (KHDRBS1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KHDRBS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KHDRBS1 antibody was raised against the N terminal of KHDRBS1

Aufreinigung: Affinity purified

Immunogen: KHDRBS1 antibody was raised using the N terminal of KHDRBS1 corresponding to a region with amino acids LPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KHDRBS1 Blocking Peptide, catalog no. 33R-5263, is also available for use as a blocking control in assays to test for specificity of this KHDRBS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHDRBS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KHDRBS1

Target: KHDRBS1 (KH Domain Containing, RNA Binding, Signal Transduction Associated 1 (KHDRBS1))

Andere Bezeichnung: KHDRBS1 (KHDRBS1 Produkte)

Synonyme: Sam68 antikoerper, p62 antikoerper, p68 antikoerper, fj90g10 antikoerper, khdrbs1 antikoerper, wu:fa18g12 antikoerper, wu:fa56c01 antikoerper, wu:fc91b01 antikoerper, wu:fj90g10 antikoerper, zgc:113899 antikoerper, KHDRBS1 antikoerper, P62 antikoerper, khdrbs1l antikoerper, sb:cb97 antikoerper, wu:fb07d11 antikoerper, wu:fi43c05 antikoerper, zgc:85948 antikoerper, KH RNA binding domain containing, signal transduction associated 1 antikoerper, KH domain containing, RNA binding, signal transduction associated 1a antikoerper, KH domain containing, RNA binding, signal transduction associated 1 antikoerper, KH domain containing, RNA binding, signal transduction associated 1 S homeolog antikoerper, KH domain containing, RNA binding, signal transduction associated 1b antikoerper, KHDRBS1 antikoerper, khdrbs1a antikoerper, khdrbs1 antikoerper, Khdrbs1 antikoerper, khdrbs1.S antikoerper, khdrbs1b antikoerper

Hintergrund: KHDRBS1 recruited and tyrosine phosphorylated by several receptor systems, for example the T-cell, leptin and insulin receptors. Once phosphorylated, KHDRBS1 functions as an adapter protein in signal transduction cascades by binding to SH2 and SH3 domain-containing proteins. KHDRBS1 play a role in G2-M progression in the cell cycle. It represses CBP-dependent transcriptional activation apparently by competing with other nuclear factors for binding to CBP. KHDRBS1 also acts as a putative regulator of mRNA stability and/or translation rates and mediates mRNA nuclear export.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: NF-kappaB Signalweg, Neurotrophin Signalübertragung, Autophagie