PSMD1 Antikörper
-
- Target Alle PSMD1 Antikörper anzeigen
- PSMD1 (Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 1 (PSMD1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PSMD1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PSMD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids HYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALE
- Top Product
- Discover our top product PSMD1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PSMD1 Blocking Peptide, catalog no. 33R-3879, is also available for use as a blocking control in assays to test for specificity of this PSMD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSMD1 (Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 1 (PSMD1))
- Andere Bezeichnung
- PSMD1 (PSMD1 Produkte)
- Synonyme
- P112 antikoerper, Rpn2 antikoerper, S1 antikoerper, 2410026J11Rik antikoerper, zgc:55818 antikoerper, psmd1 antikoerper, proteasome 26S subunit, non-ATPase 1 antikoerper, proteasome (prosome, macropain) 26S subunit, non-ATPase, 1 antikoerper, proteasome 26S subunit, non-ATPase 1 L homeolog antikoerper, PSMD1 antikoerper, Psmd1 antikoerper, psmd1 antikoerper, psmd1.L antikoerper
- Hintergrund
- The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator.
- Molekulargewicht
- 106 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA, Ubiquitin Proteasome Pathway
-