Cyclin B1 Antikörper (Middle Region)
-
- Target Alle Cyclin B1 (CCNB1) Antikörper anzeigen
- Cyclin B1 (CCNB1)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Cyclin B1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Cyclin B1 antibody was raised against the middle region of CCNB1
- Aufreinigung
- Affinity purified
- Immunogen
- Cyclin B1 antibody was raised using the middle region of CCNB1 corresponding to a region with amino acids AKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
- Top Product
- Discover our top product CCNB1 Primärantikörper
-
anti-Cyclin B1 (CCNB1) antibody
CCNB1 Reaktivität: Human WB, IF, IHC (p), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Cyclin B1 (CCNB1) (C-Term) antibodyCCNB1 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Cyclin B1 (CCNB1) antibodyCCNB1 Reaktivität: Human, Maus IHC, StM Wirt: Maus Monoclonal CCNB1-1098 unconjugated
anti-Cyclin B1 (CCNB1) (C-Term) antibodyCCNB1 Reaktivität: Human WB, IHC, IF, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Cyclin B1 (CCNB1) (AA 1-21) antibodyCCNB1 Reaktivität: Human, Maus, Hamster WB, IHC, FACS, IP, BI, FM Wirt: Maus Monoclonal GNS-1 unconjugated
anti-Cyclin B1 (CCNB1) (AA 271-433) antibodyCCNB1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Huhn WB, ELISA, FACS, IHC (p), IF (cc), IF (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Cyclin B1 (CCNB1) (AA 1-433) antibodyCCNB1 Reaktivität: Human WB, PLA Wirt: Kaninchen Polyclonal unconjugated
anti-Cyclin B1 (CCNB1) antibodyCCNB1 Reaktivität: Human, Ratte WB, ELISA, FACS, ICC Wirt: Maus Monoclonal 5G6 unconjugated
anti-Cyclin B1 (CCNB1) antibodyCCNB1 Reaktivität: Human WB, ELISA, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Cyclin B1 (CCNB1) (AA 1-90) antibodyCCNB1 Reaktivität: Human WB, ELISA, IHC (p) Wirt: Maus Monoclonal 1C8 unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Cyclin B1 Blocking Peptide, catalog no. 33R-1305, is also available for use as a blocking control in assays to test for specificity of this Cyclin B1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCNB1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cyclin B1 (CCNB1)
- Andere Bezeichnung
- Cyclin B1 (CCNB1 Produkte)
- Synonyme
- ccnb antikoerper, cycb antikoerper, cb267 antikoerper, cycb1 antikoerper, wu:fa19g04 antikoerper, wu:fb16d01 antikoerper, wu:fb16e07 antikoerper, wu:fi21c01 antikoerper, ccnb1 antikoerper, MGC53596 antikoerper, CCNB antikoerper, Ccnb1-rs1 antikoerper, Ccnb1-rs13 antikoerper, CycB1 antikoerper, Cycb-4 antikoerper, Cycb-5 antikoerper, Cycb1-rs1 antikoerper, cyclin B1 antikoerper, cyclin B1 S homeolog antikoerper, ccnb1 antikoerper, ccnb1.2 antikoerper, ccnb1.S antikoerper, CCNB1 antikoerper, Ccnb1 antikoerper, ccnb1.2.S antikoerper
- Hintergrund
- CCNB1 is a regulatory protein involved in mitosis. CCNB1 complexes with p34(cdc2) to form the maturation-promoting factor (MPF). The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase. The different transcripts result from the use of alternate transcription initiation sites.
- Molekulargewicht
- 48 kDa (MW of target protein)
- Pathways
- Zellzyklus, AMPK Signaling, Mitotic G1-G1/S Phases, M Phase
-
