POLB Antikörper
-
- Target Alle POLB Antikörper anzeigen
- POLB (Polymerase (DNA Directed), beta (POLB))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser POLB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- POLB antibody was raised using a synthetic peptide corresponding to a region with amino acids GPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEML
- Top Product
- Discover our top product POLB Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
POLB Blocking Peptide, catalog no. 33R-3482, is also available for use as a blocking control in assays to test for specificity of this POLB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- POLB (Polymerase (DNA Directed), beta (POLB))
- Andere Bezeichnung
- POLB (POLB Produkte)
- Synonyme
- wu:fa97a05 antikoerper, zgc:109924 antikoerper, POLB antikoerper, DDBDRAFT_0186152 antikoerper, DDBDRAFT_0215784 antikoerper, DDBDRAFT_0232376 antikoerper, DDB_0186152 antikoerper, DDB_0215784 antikoerper, DDB_0232376 antikoerper, A430088C08Rik antikoerper, polymerase (DNA directed), beta antikoerper, DNA polymerase beta antikoerper, DNA polymerase X family protein antikoerper, polymerase (DNA directed), beta S homeolog antikoerper, polb antikoerper, POLB antikoerper, polB antikoerper, polb.S antikoerper, Polb antikoerper
- Hintergrund
- In eukaryotic cells, DNA polymerase beta (POLB) performs base excision repair (BER) required for DNA maintenance, replication, recombination, and drug resistance.
- Molekulargewicht
- 38 kDa (MW of target protein)
- Pathways
- DNA Reparatur
-