MCM7 Antikörper (Middle Region)
-
- Target Alle MCM7 Antikörper anzeigen
- MCM7 (Minichromosome Maintenance Complex Component 7 (MCM7))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MCM7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MCM7 antibody was raised against the middle region of MCM7
- Aufreinigung
- Affinity purified
- Immunogen
- MCM7 antibody was raised using the middle region of MCM7 corresponding to a region with amino acids LSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVI
- Top Product
- Discover our top product MCM7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MCM7 Blocking Peptide, catalog no. 33R-5458, is also available for use as a blocking control in assays to test for specificity of this MCM7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MCM7 (Minichromosome Maintenance Complex Component 7 (MCM7))
- Andere Bezeichnung
- MCM7 (MCM7 Produkte)
- Synonyme
- CDC47 antikoerper, MCM2 antikoerper, P1.1-MCM3 antikoerper, P1CDC47 antikoerper, P85MCM antikoerper, PNAS146 antikoerper, MCM7 antikoerper, AI747533 antikoerper, Mcmd7 antikoerper, mCDC47 antikoerper, chunp6911 antikoerper, nyz175 antikoerper, sr:nyz175 antikoerper, cdc47 antikoerper, cdc47-2 antikoerper, mcm7 antikoerper, xmcm7 antikoerper, CG4978 antikoerper, DmMCM7 antikoerper, DmeMCM7 antikoerper, Dmel\\CG4978 antikoerper, McM7 antikoerper, Mcp-PCR1 antikoerper, PCR1 antikoerper, anon-EST:Liang-1.66 antikoerper, clone 1.66 antikoerper, minichromosome maintenance complex component 7 antikoerper, mini-chromosome maintenance complex protein 7 antikoerper, minichromosome maintenance complex component 2 antikoerper, minichromosome maintenance complex component 7 L homeolog antikoerper, Minichromosome maintenance 7 antikoerper, minichromosome maintenance complex component 7 S homeolog antikoerper, MCM complex subunit Mcm7 antikoerper, MCM7 antikoerper, CDC47 antikoerper, Mcm7 antikoerper, MCM2 antikoerper, mcm7 antikoerper, mcm7.L antikoerper, mcm7.S antikoerper
- Hintergrund
- MCM7 encodes a protein that is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. Cyclin D1-dependent kinase, CDK4, is found to associate with this protein, and may regulate the binding of this protein with the tumorsuppressor protein RB1/RB.
- Molekulargewicht
- 81 kDa (MW of target protein)
- Pathways
- DNA Reparatur, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA
-