Glutaminase Antikörper (Middle Region)

Produktnummer ABIN634050

Produktdetails anti-Glutaminase Antikörper

Target: Glutaminase (GLS)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Glutaminase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GLS antibody was raised against the middle region of GLS

Aufreinigung: Affinity purified

Immunogen: GLS antibody was raised using the middle region of GLS corresponding to a region with amino acids VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GLS Blocking Peptide, catalog no. 33R-9711, is also available for use as a blocking control in assays to test for specificity of this GLS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Glutaminase

Target: Glutaminase (GLS)

Andere Bezeichnung: GLS (GLS Produkte)

Synonyme: Glut antikoerper, RATGLUT antikoerper, gls antikoerper, si:dz87i4.2 antikoerper, wu:fa97e05 antikoerper, GA antikoerper, PAG antikoerper, AAD20 antikoerper, GAC antikoerper, GAM antikoerper, GLS1 antikoerper, KGA antikoerper, AI314027 antikoerper, 6330442B14 antikoerper, B230365M23Rik antikoerper, CG8772 antikoerper, CG8872 antikoerper, Dmel\\CG42708 antikoerper, Dmel_CG8772 antikoerper, BA3155 antikoerper, glutaminase antikoerper, glutaminase b antikoerper, Glutaminase antikoerper, glutaminase kidney isoform, mitochondrial antikoerper, Gls antikoerper, GLS antikoerper, gls antikoerper, glsb antikoerper, glsA2 antikoerper, glsA-2 antikoerper, Arnit_3113 antikoerper, Celal_2913 antikoerper, Celly_0289 antikoerper, Weevi_2101 antikoerper, Mesop_4683 antikoerper, LOC100069617 antikoerper

Hintergrund: Sahai demonstrated phosphate-activated glutaminase in human platelets. It is the major enzyme yielding glutamate from glutamine.

Molekulargewicht: 73 kDa (MW of target protein)

Pathways: Feeding Behaviour, Dicarboxylic Acid Transport, Warburg Effekt