PDIA6 Antikörper (Middle Region)
-
- Target Alle PDIA6 Antikörper anzeigen
- PDIA6 (Protein Disulfide Isomerase Family A, Member 6 (PDIA6))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PDIA6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PDIA6 antibody was raised against the middle region of PDIA6
- Aufreinigung
- Affinity purified
- Immunogen
- PDIA6 antibody was raised using the middle region of PDIA6 corresponding to a region with amino acids KLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRA
- Top Product
- Discover our top product PDIA6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PDIA6 Blocking Peptide, catalog no. 33R-4499, is also available for use as a blocking control in assays to test for specificity of this PDIA6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDIA6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDIA6 (Protein Disulfide Isomerase Family A, Member 6 (PDIA6))
- Andere Bezeichnung
- PDIA6 (PDIA6 Produkte)
- Synonyme
- 1700015E05Rik antikoerper, AL023058 antikoerper, C77895 antikoerper, CaBP5 antikoerper, P5 antikoerper, Txndc7 antikoerper, ERP5 antikoerper, TXNDC7 antikoerper, CaBP1 antikoerper, pdi-p5 antikoerper, erp5 antikoerper, pdia6 antikoerper, pdip5 antikoerper, txndc7 antikoerper, protein disulfide isomerase family A member 6 antikoerper, protein disulfide isomerase associated 6 antikoerper, protein disulfide isomerase family A, member 6 antikoerper, protein disulfide isomerase family A member 6 L homeolog antikoerper, PDIA6 antikoerper, Pdia6 antikoerper, pdia6.L antikoerper
- Hintergrund
- Protein disulfide isomerases, such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins.
- Molekulargewicht
- 48 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling, Cell RedoxHomeostasis
-