WNT2 Antikörper (Middle Region)

Produktnummer ABIN633953

Produktdetails anti-WNT2 Antikörper

Target: WNT2 (Wingless-Type MMTV Integration Site Family Member 2 (WNT2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WNT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WNT2 antibody was raised against the middle region of WNT2

Aufreinigung: Affinity purified

Immunogen: WNT2 antibody was raised using the middle region of WNT2 corresponding to a region with amino acids GSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WNT2 Blocking Peptide, catalog no. 33R-3548, is also available for use as a blocking control in assays to test for specificity of this WNT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WNT2

Target: WNT2 (Wingless-Type MMTV Integration Site Family Member 2 (WNT2))

Andere Bezeichnung: WNT2 (WNT2 Produkte)

Synonyme: CG1916 antikoerper, D-wnt-2 antikoerper, DWnt-2 antikoerper, DWnt2 antikoerper, Dm DWnt2 antikoerper, Dm-2 antikoerper, Dmel\\CG1916 antikoerper, Dwnt-2 antikoerper, Wnt antikoerper, Wnt-2 antikoerper, dWnt2 antikoerper, wnt2 antikoerper, WNT2 antikoerper, irp antikoerper, Xwnt2 antikoerper, wnt-2 antikoerper, Xwnt-2 antikoerper, int1l1 antikoerper, 2610510E18Rik antikoerper, Int1l1 antikoerper, Irp antikoerper, Mirp antikoerper, Wnt2a antikoerper, INT1L1 antikoerper, IRP antikoerper, ZfWnt2 antikoerper, Wnt oncogene analog 2 antikoerper, Wnt family member 2 antikoerper, wingless-type MMTV integration site family member 2 antikoerper, wingless-type MMTV integration site family, member 2 antikoerper, Wnt2 antikoerper, wnt2 antikoerper, WNT2 antikoerper

Hintergrund: WNT2 is the ligand for members of the frizzled family of seven transmembrane receptors. WNT2 is a probable developmental protein. WNT2 may be a signaling molecule which affects the development of discrete regions of tissues. WNT2 is likely to signal over only few cell diameters.

Molekulargewicht: 38 kDa (MW of target protein)

Pathways: WNT Signalweg