Cholesterol Esterase Antikörper

Produktnummer ABIN633939

Produktdetails anti-Cholesterol Esterase Antikörper

Target: Cholesterol Esterase (CEL)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cholesterol Esterase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Carboxyl Ester Lipase antibody was raised using a synthetic peptide corresponding to a region with amino acids VTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carboxyl Ester Lipase Blocking Peptide, catalog no. 33R-9855, is also available for use as a blocking control in assays to test for specificity of this Carboxyl Ester Lipase antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cholesterol Esterase

Target: Cholesterol Esterase (CEL)

Andere Bezeichnung: Carboxyl Ester Lipase (CEL Produkte)

Synonyme: SC8F4.24 antikoerper, BAL antikoerper, BSDL antikoerper, BSSL antikoerper, CELL antikoerper, CEase antikoerper, FAP antikoerper, FAPP antikoerper, LIPA antikoerper, MODY8 antikoerper, 1810036E18Rik antikoerper, Bal antikoerper, Bssl antikoerper, carboxyl ester lipase antikoerper, cholesterol esterase antikoerper, hypothetical protein antikoerper, CEL antikoerper, SCO5420 antikoerper, Tfu_2331 antikoerper, SARE_RS01070 antikoerper, RSal33209_1252 antikoerper, Caci_5976 antikoerper, Ndas_0054 antikoerper, Micau_5972 antikoerper, ML5_2523 antikoerper, Cel antikoerper, cel antikoerper

Hintergrund: CEL catalyzes fat and vitamin absorption. CEL acts in concert with pancreatic lipase and colipase for the complete digestion of dietary triglycerides.

Molekulargewicht: 80 kDa (MW of target protein)

Pathways: Lipid Metabolism