Cholesterol Esterase Antikörper

Produktnummer ABIN633939

Der Kaninchen Polyklonal anti-Cholesterol Esterase Antikörper (ABIN633939) detektiert spezifisch Cholesterol Esterase in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für Cholesterol Esterase Antikörper (ABIN633939)

Target: Cholesterol Esterase (CEL)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cholesterol Esterase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Cholesterol Esterase Antikörper

Aufreinigung: Affinity purified

Immunogen: Carboxyl Ester Lipase antibody was raised using a synthetic peptide corresponding to a region with amino acids VTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carboxyl Ester Lipase Blocking Peptide, (ABIN5612609), is also available for use as a blocking control in assays to test for specificity of this Carboxyl Ester Lipase antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cholesterol Esterase

Target: Cholesterol Esterase (CEL)

Andere Bezeichnung: Carboxyl Ester Lipase

Hintergrund: CEL catalyzes fat and vitamin absorption. CEL acts in concert with pancreatic lipase and colipase for the complete digestion of dietary triglycerides.

Molekulargewicht: 80 kDa (MW of target protein)

Pathways: Lipid Metabolism