PCSK5 Antikörper (Middle Region)

Produktnummer ABIN633925

Produktdetails anti-PCSK5 Antikörper

Target: PCSK5 (Proprotein Convertase Subtilisin/kexin Type 5 (PCSK5))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCSK5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PCSK5 antibody was raised against the middle region of PCSK5

Aufreinigung: Affinity purified

Immunogen: PCSK5 antibody was raised using the middle region of PCSK5 corresponding to a region with amino acids CAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDIS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCSK5 Blocking Peptide, catalog no. 33R-1642, is also available for use as a blocking control in assays to test for specificity of this PCSK5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCSK5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCSK5

Target: PCSK5 (Proprotein Convertase Subtilisin/kexin Type 5 (PCSK5))

Andere Bezeichnung: PCSK5 (PCSK5 Produkte)

Synonyme: PC5 antikoerper, PC6 antikoerper, PC6A antikoerper, SPC6 antikoerper, subtilase antikoerper, PC5/6A antikoerper, PC5A antikoerper, b2b1549Clo antikoerper, b2b585Clo antikoerper, Pc5 antikoerper, fur2 antikoerper, spc6 antikoerper, spc6A antikoerper, MGC98915 antikoerper, PCSK5 antikoerper, pc6 antikoerper, spc6a antikoerper, pcsk5 antikoerper, zgc:165659 antikoerper, proprotein convertase subtilisin/kexin type 5 antikoerper, proprotein convertase subtilisin/kexin type 5 S homeolog antikoerper, proprotein convertase subtilisin/kexin type 5b antikoerper, PCSK5 antikoerper, Pcsk5 antikoerper, pcsk5.S antikoerper, LOC528098 antikoerper, pcsk5 antikoerper, pcsk5b antikoerper

Hintergrund: PCSK5 belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. PCSK5 mediates posttranslational endoproteolytic processing for several integrin alpha subunits. It is thought to process prorenin, pro-membrane type-1 matrix metalloproteinase and HIV-1 glycoprotein gp160. Two alternatively spliced transcripts are described for this gene but only one has its full length nature known.

Molekulargewicht: 89 kDa (MW of target protein)

Pathways: Neurotrophin Signalübertragung, Regulation of Systemic Arterial Blood Pressure by Hormones