Endonuclease G Antikörper (Middle Region)
-
- Target Alle Endonuclease G (ENDOG) Antikörper anzeigen
- Endonuclease G (ENDOG)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Endonuclease G Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ENDOG antibody was raised against the middle region of ENDOG
- Aufreinigung
- Affinity purified
- Immunogen
- ENDOG antibody was raised using the middle region of ENDOG corresponding to a region with amino acids YVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGS
- Top Product
- Discover our top product ENDOG Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ENDOG Blocking Peptide, catalog no. 33R-10281, is also available for use as a blocking control in assays to test for specificity of this ENDOG antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENDOG antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Endonuclease G (ENDOG)
- Andere Bezeichnung
- ENDOG (ENDOG Produkte)
- Synonyme
- CG8862 antikoerper, Dmel\\CG8862 antikoerper, Tb08.10J17.140 antikoerper, Tb08.10J17.90 antikoerper, TBC1D13 antikoerper, endog antikoerper, ENDOG antikoerper, wu:fb79c08 antikoerper, zgc:110020 antikoerper, Endonuclease G antikoerper, endonuclease G antikoerper, putative endonuclease G antikoerper, endonuclease G, mitochondrial antikoerper, endonuclease G L homeolog antikoerper, EndoG antikoerper, Tc00.1047053506867.10 antikoerper, Tb927.8.4040 antikoerper, Tb927.8.4090 antikoerper, LBRM_10_0750 antikoerper, LMJF_10_0610 antikoerper, NAEGRDRAFT_78507 antikoerper, ENDOG antikoerper, endog antikoerper, eNDOG antikoerper, LOC100529218 antikoerper, Endog antikoerper, endog.L antikoerper
- Hintergrund
- ENDOG cleaves DNA at double-stranded (DG)n.(DC)n and at single-stranded (DC)n tracts. In addition to deoxyribonuclease activities, ENDOG also has ribonuclease (RNase) and RNase H activities. ENDOG is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA.
- Molekulargewicht
- 28 kDa (MW of target protein)
- Pathways
- Apoptose
-