GSTM3 Antikörper

Produktnummer ABIN633805

Produktdetails anti-GSTM3 Antikörper

Target: GSTM3 (Glutathione S-Transferase mu 3 (Brain) (GSTM3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GSTM3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GSTM3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GSTM3 Blocking Peptide, catalog no. 33R-8636, is also available for use as a blocking control in assays to test for specificity of this GSTM3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTM3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GSTM3

Target: GSTM3 (Glutathione S-Transferase mu 3 (Brain) (GSTM3))

Andere Bezeichnung: GSTM3 (GSTM3 Produkte)

Synonyme: GST5 antikoerper, GSTB antikoerper, GSTM3-3 antikoerper, GTM3 antikoerper, Fsc2 antikoerper, mGSTM5 antikoerper, glutathione S-transferase mu 3 antikoerper, glutathione S-transferase Mu 3 antikoerper, glutathione S-transferase, mu 3 antikoerper, GSTM3 antikoerper, Gstm3 antikoerper, LOC479911 antikoerper

Hintergrund: Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. GSTM3 is a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione.

Molekulargewicht: 26 kDa (MW of target protein)