SCN1B Antikörper (Middle Region)
-
- Target Alle SCN1B Antikörper anzeigen
- SCN1B (Sodium Channel, Voltage-Gated, Type I, beta (SCN1B))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SCN1B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SCN1 B antibody was raised against the middle region of SCN1
- Aufreinigung
- Affinity purified
- Immunogen
- SCN1 B antibody was raised using the middle region of SCN1 corresponding to a region with amino acids NVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVS
- Top Product
- Discover our top product SCN1B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SCN1B Blocking Peptide, catalog no. 33R-6928, is also available for use as a blocking control in assays to test for specificity of this SCN1B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCN0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SCN1B (Sodium Channel, Voltage-Gated, Type I, beta (SCN1B))
- Andere Bezeichnung
- SCN1B (SCN1B Produkte)
- Synonyme
- GEFSP1 antikoerper, sodium channel, voltage-gated, type I, beta antikoerper, sodium voltage-gated channel beta subunit 1 antikoerper, Scn1b antikoerper, SCN1B antikoerper
- Hintergrund
- Voltage-gated sodium channels are essential for the generation and propagation of action potentials in striated muscle and neuronal tissues. Biochemically, they consist of a large alpha subunit and 1 or 2 smaller beta subunits, such as SCN1B. The alpha subunit alone can exhibit all the functional attributes of a voltage-gated Na+ channel, but requires a beta-1 subunit for normal inactivation kinetics.
- Molekulargewicht
- 25 kDa (MW of target protein)
-