KCNH2 Antikörper

Produktnummer ABIN633738

Produktdetails anti-KCNH2 Antikörper

Target: KCNH2 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 2 (KCNH2))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNH2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: KCNH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNH2 Blocking Peptide, catalog no. 33R-8732, is also available for use as a blocking control in assays to test for specificity of this KCNH2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNH2

Target: KCNH2 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 2 (KCNH2))

Andere Bezeichnung: KCNH2 (KCNH2 Produkte)

Synonyme: ERG1 antikoerper, HERG antikoerper, HERG1 antikoerper, Kv11.1 antikoerper, LQT2 antikoerper, SQT1 antikoerper, erg antikoerper, KCNH2 antikoerper, ERG antikoerper, gp-erg antikoerper, cerg antikoerper, derg antikoerper, erg1 antikoerper, AI326795 antikoerper, LQT antikoerper, Lqt2 antikoerper, M-erg antikoerper, Merg1 antikoerper, merg1a antikoerper, merg1b antikoerper, potassium voltage-gated channel subfamily H member 2 antikoerper, potassium voltage-gated channel, subfamily H (eag-related), member 6a antikoerper, potassium voltage-gated channel, subfamily H (eag-related), member 2 antikoerper, potassium voltage-gated channel subfamily H member 6 antikoerper, KCNH2 antikoerper, kcnh6a antikoerper, Kcnh2 antikoerper, KCNH6 antikoerper

Hintergrund: This gene encodes a voltage-activated potassium channel belonging to the eag family. It shares sequence similarity with the Drosophila ether-a-go-go (eag) gene. Mutations in this gene can cause long QT syndrome type 2 (LQT2).

Molekulargewicht: 90 kDa (MW of target protein)