KCNH2 Antikörper (C-Term, Intracellular)
-
- Target Alle KCNH2 Antikörper anzeigen
- KCNH2 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 2 (KCNH2))
-
Bindungsspezifität
- AA 1106-1159, C-Term, Intracellular
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCNH2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunoprecipitation (IP)
- Kreuzreaktivität (Details)
- The antibody recognizes the HERG1b splice variant but not splice variants HERG1-3 and HERG-4
- Produktmerkmale
- Anti-KCNH2 (HERG) Antibody is directed against an intracellular epitope of the human KV11.1 channel. Anti-KCNH2 (HERG) Antibody (ABIN7043544, ABIN7044976 and ABIN7044977)) can be used in western blot, immunoprecipitation, immunohistochemical and immunocytochemical applications. It has been designed to recognize KV11.1 from human, rat, and mouse samples.
- Aufreinigung
- The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
- Immunogen
-
Immunogen: GST fusion protein
Immunogen Sequence: GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human KV11.1 (HERG)
- Isotyp
- IgG
- Top Product
- Discover our top product KCNH2 Primärantikörper
-
-
- Applikationshinweise
- Optimal working dilution should be determined by the investigator.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- 25 μL, 50 μL or 0.2 mL double distilled water (DDW), depending on the sample size.
- Konzentration
- 0.6 mg/mL
- Buffer
- Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1 % BSA, 0.05 % Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- RT,4 °C,-20 °C
- Informationen zur Lagerung
-
Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
-
- Target
- KCNH2 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 2 (KCNH2))
- Andere Bezeichnung
- KCNH2 (HERG) (KCNH2 Produkte)
- Synonyme
- ERG1 antikoerper, HERG antikoerper, HERG1 antikoerper, Kv11.1 antikoerper, LQT2 antikoerper, SQT1 antikoerper, erg antikoerper, KCNH2 antikoerper, ERG antikoerper, gp-erg antikoerper, cerg antikoerper, derg antikoerper, erg1 antikoerper, AI326795 antikoerper, LQT antikoerper, Lqt2 antikoerper, M-erg antikoerper, Merg1 antikoerper, merg1a antikoerper, merg1b antikoerper, potassium voltage-gated channel subfamily H member 2 antikoerper, potassium voltage-gated channel, subfamily H (eag-related), member 6a antikoerper, potassium voltage-gated channel, subfamily H (eag-related), member 2 antikoerper, potassium voltage-gated channel subfamily H member 6 antikoerper, KCNH2 antikoerper, kcnh6a antikoerper, Kcnh2 antikoerper, KCNH6 antikoerper
- Hintergrund
- Alternative names: KCNH2 (HERG), KV11.1, Potassium voltage-gated channel subfamily H member 2, Ether-a-go-go-related channel 1
- Gen-ID
- 3757
- NCBI Accession
- NM_000238
- UniProt
- Q12809
-