KCNAB1 Antikörper (C-Term)

Produktnummer ABIN633614

Produktdetails anti-KCNAB1 Antikörper

Target: KCNAB1 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 1 (KCNAB1))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNAB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNAB1 antibody was raised against the C terminal of KCNAB1

Aufreinigung: Affinity purified

Immunogen: KCNAB1 antibody was raised using the C terminal of KCNAB1 corresponding to a region with amino acids VPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNAB1 Blocking Peptide, catalog no. 33R-9721, is also available for use as a blocking control in assays to test for specificity of this KCNAB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNAB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNAB1

Target: KCNAB1 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 1 (KCNAB1))

Andere Bezeichnung: KCNAB1 (KCNAB1 Produkte)

Synonyme: KCNAB1 antikoerper, zgc:113627 antikoerper, AKR6A3 antikoerper, KCNA1B antikoerper, KV-BETA-1 antikoerper, Kvb1.3 antikoerper, hKvBeta3 antikoerper, hKvb3 antikoerper, Kvbeta1.1 antikoerper, KVBETA1 antikoerper, Kv-beta-1 antikoerper, Akr8a8 antikoerper, mKv(beta)1 antikoerper, KvBeta3 antikoerper, potassium voltage-gated channel subfamily A member regulatory beta subunit 1 antikoerper, potassium voltage-gated channel, shaker-related subfamily, beta member 1 a antikoerper, potassium voltage-gated channel, shaker-related subfamily, beta member 1 antikoerper, KCNAB1 antikoerper, kcnab1a antikoerper, Kcnab1 antikoerper

Hintergrund: Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.

Molekulargewicht: 46 kDa (MW of target protein)