SRGN Antikörper (Middle Region)

Produktnummer ABIN633597

Produktdetails anti-SRGN Antikörper

Target: SRGN (serglycin (SRGN))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SRGN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Serglycin antibody was raised against the middle region of SRGN

Aufreinigung: Affinity purified

Immunogen: Serglycin antibody was raised using the middle region of SRGN corresponding to a region with amino acids RTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Serglycin Blocking Peptide, catalog no. ABIN5616055, is also available for use as a blocking control in assays to test for specificity of this Serglycin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRGN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SRGN

Target: SRGN (serglycin (SRGN))

Andere Bezeichnung: Serglycin (SRGN Produkte)

Synonyme: PPG antikoerper, PRG antikoerper, PRG1 antikoerper, Prg antikoerper, Prg1 antikoerper, Sgc antikoerper, Pgsg antikoerper, serglycin antikoerper, SRGN antikoerper, Srgn antikoerper

Hintergrund: SRGN is a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. SRGN was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis.

Molekulargewicht: 15 kDa (MW of target protein)

Pathways: Maintenance of Protein Location