PCBP1 Antikörper

Produktnummer ABIN633568

Produktdetails anti-PCBP1 Antikörper

Target: PCBP1 (Poly(rC) Binding Protein 1 (PCBP1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCBP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PCBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCBP1 Blocking Peptide, catalog no. 33R-7142, is also available for use as a blocking control in assays to test for specificity of this PCBP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCBP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCBP1

Target: PCBP1 (Poly(rC) Binding Protein 1 (PCBP1))

Andere Bezeichnung: PCBP1 (PCBP1 Produkte)

Synonyme: PCBP1 antikoerper, HNRPE1 antikoerper, HNRPX antikoerper, hnRNP-E1 antikoerper, hnRNP-X antikoerper, hnRNP E1 antikoerper, WBP17 antikoerper, [a]CP-1 antikoerper, alphaCP-1 antikoerper, RGD1561319 antikoerper, poly(rC) binding protein 1 antikoerper, poly(rC) binding protein 1 L homeolog antikoerper, poly(rC)-binding protein 1 antikoerper, PCBP1 antikoerper, pcbp1.L antikoerper, LOC100388387 antikoerper, Pcbp1 antikoerper

Hintergrund: PCBP1 appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in RNA binding. This protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure.

Molekulargewicht: 37 kDa (MW of target protein)