PTBP1 Antikörper (Middle Region)

Produktnummer ABIN633200

Produktdetails anti-PTBP1 Antikörper

Target: PTBP1 (Polypyrimidine Tract Binding Protein 1 (PTBP1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTBP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PTBP1 antibody was raised against the middle region of PTBP1

Aufreinigung: Affinity purified

Immunogen: PTBP1 antibody was raised using the middle region of PTBP1 corresponding to a region with amino acids KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PTBP1 Blocking Peptide, catalog no. 33R-4388, is also available for use as a blocking control in assays to test for specificity of this PTBP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTBP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PTBP1

Target: PTBP1 (Polypyrimidine Tract Binding Protein 1 (PTBP1))

Andere Bezeichnung: PTBP1 (PTBP1 Produkte)

Synonyme: HNRNP-I antikoerper, HNRNPI antikoerper, HNRPI antikoerper, PTB antikoerper, PTB-1 antikoerper, PTB-T antikoerper, PTB2 antikoerper, PTB3 antikoerper, PTB4 antikoerper, pPTB antikoerper, Ptb antikoerper, hnrpi antikoerper, hnrnp-I antikoerper, vgrbp60 antikoerper, AA407203 antikoerper, AL033359 antikoerper, Pybp antikoerper, Pybp1 antikoerper, Pybp2 antikoerper, ptbp1 antikoerper, wu:fb99f12 antikoerper, zgc:110689 antikoerper, ptb antikoerper, ATPTB1 antikoerper, POLYPYRIMIDINE TRACT-BINDING antikoerper, POLYPYRIMIDINE TRACT-BINDING PROTEIN 1 antikoerper, T4P13.16 antikoerper, T4P13_16 antikoerper, polypyrimidine tract-binding protein 1 antikoerper, PTBP1 antikoerper, polypyrimidine tract binding protein 1 antikoerper, polypyrimidine tract binding protein 1 S homeolog antikoerper, polypyrimidine tract-binding protein antikoerper, polypyrimidine tract binding protein 1a antikoerper, polypyrimidine tract binding protein 1 L homeolog antikoerper, polypyrimidine tract-binding protein 1 antikoerper, PTBP1 antikoerper, ptbp1.S antikoerper, NAEGRDRAFT_80143 antikoerper, LOC100285404 antikoerper, Ptbp1 antikoerper, ptbp1a antikoerper, ptbp1.L antikoerper, PTB1 antikoerper, LOC100061673 antikoerper

Hintergrund: PTBP1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport.

Molekulargewicht: 60 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation