PTBP1 Antikörper (N-Term)
-
- Target Alle PTBP1 Antikörper anzeigen
- PTBP1 (Polypyrimidine Tract Binding Protein 1 (PTBP1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PTBP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PTBP1 antibody was raised against the N terminal of PTBP1
- Aufreinigung
- Affinity purified
- Immunogen
- PTBP1 antibody was raised using the N terminal of PTBP1 corresponding to a region with amino acids RGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHI
- Top Product
- Discover our top product PTBP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PTBP1 Blocking Peptide, catalog no. 33R-7938, is also available for use as a blocking control in assays to test for specificity of this PTBP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTBP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PTBP1 (Polypyrimidine Tract Binding Protein 1 (PTBP1))
- Andere Bezeichnung
- PTBP1 (PTBP1 Produkte)
- Synonyme
- HNRNP-I antikoerper, HNRNPI antikoerper, HNRPI antikoerper, PTB antikoerper, PTB-1 antikoerper, PTB-T antikoerper, PTB2 antikoerper, PTB3 antikoerper, PTB4 antikoerper, pPTB antikoerper, Ptb antikoerper, hnrpi antikoerper, hnrnp-I antikoerper, vgrbp60 antikoerper, AA407203 antikoerper, AL033359 antikoerper, Pybp antikoerper, Pybp1 antikoerper, Pybp2 antikoerper, ptbp1 antikoerper, wu:fb99f12 antikoerper, zgc:110689 antikoerper, ptb antikoerper, ATPTB1 antikoerper, POLYPYRIMIDINE TRACT-BINDING antikoerper, POLYPYRIMIDINE TRACT-BINDING PROTEIN 1 antikoerper, T4P13.16 antikoerper, T4P13_16 antikoerper, polypyrimidine tract-binding protein 1 antikoerper, PTBP1 antikoerper, polypyrimidine tract binding protein 1 antikoerper, polypyrimidine tract binding protein 1 S homeolog antikoerper, polypyrimidine tract-binding protein antikoerper, polypyrimidine tract binding protein 1a antikoerper, polypyrimidine tract binding protein 1 L homeolog antikoerper, polypyrimidine tract-binding protein 1 antikoerper, PTBP1 antikoerper, ptbp1.S antikoerper, NAEGRDRAFT_80143 antikoerper, LOC100285404 antikoerper, Ptbp1 antikoerper, ptbp1a antikoerper, ptbp1.L antikoerper, PTB1 antikoerper, LOC100061673 antikoerper
- Hintergrund
- PTBP1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport.
- Molekulargewicht
- 58 kDa (MW of target protein)
- Pathways
- Regulation of Muscle Cell Differentiation
-