DNA2 Antikörper (Middle Region)

Produktnummer ABIN633186

Produktdetails anti-DNA2 Antikörper

Target: DNA2 (DNA Replication Helicase 2 Homolog (DNA2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DNA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DNA2 L antibody was raised against the middle region of Dna2

Aufreinigung: Affinity purified

Immunogen: DNA2 L antibody was raised using the middle region of Dna2 corresponding to a region with amino acids KLELEFYADYSDNPWLMGVFEPNNPVCFLNTDKVPAPEQVEKGGVSNVTE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DNA2L Blocking Peptide, catalog no. 33R-4506, is also available for use as a blocking control in assays to test for specificity of this DNA2L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNA0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DNA2

Target: DNA2 (DNA Replication Helicase 2 Homolog (DNA2))

Andere Bezeichnung: DNA2L (DNA2 Produkte)

Synonyme: DNA2L antikoerper, Dna2l antikoerper, E130315B21Rik antikoerper, PEOA6 antikoerper, hDNA2 antikoerper, XDna2 antikoerper, dna2-A antikoerper, DNA replication helicase/nuclease 2 antikoerper, DNA replication helicase/nuclease 2 S homeolog antikoerper, DNA2 antikoerper, Dna2 antikoerper, dna2.S antikoerper

Hintergrund: DNA2L belongs to the DNA2/NAM7 helicase family. It may function in chromosomal DNA replication.

Molekulargewicht: 54 kDa (MW of target protein)

Pathways: Telomere Maintenance, DNA Reparatur, DNA Replication, Synthesis of DNA