BBS4 Antikörper (Middle Region)

Produktnummer ABIN633149

Produktdetails anti-BBS4 Antikörper

Target: BBS4 (Bardet-Biedl Syndrome 4 (BBS4))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BBS4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BBS4 antibody was raised against the middle region of BBS4

Aufreinigung: Affinity purified

Immunogen: BBS4 antibody was raised using the middle region of BBS4 corresponding to a region with amino acids LGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVVAC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BBS4 Blocking Peptide, catalog no. 33R-4978, is also available for use as a blocking control in assays to test for specificity of this BBS4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BBS4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BBS4

Target: BBS4 (Bardet-Biedl Syndrome 4 (BBS4))

Andere Bezeichnung: BBS4 (BBS4 Produkte)

Synonyme: CG13232 antikoerper, Dmel\\CG13232 antikoerper, zgc:152964 antikoerper, AW537059 antikoerper, AW742241 antikoerper, D9Ertd464e antikoerper, Bardet-Biedl syndrome 4 antikoerper, bardet-biedl syndrome 4 antikoerper, Bardet-Biedl syndrome 4 (human) antikoerper, BBS4 antikoerper, bbs4 antikoerper, Bbs4 antikoerper

Hintergrund: This gene is a member of the Bardet-Biedl syndrome (BBS) gene family. Bardet-Biedl syndrome is an autosomal recessive disorder characterized by severe pigmentary retinopathy, obesity, polydactyly, renal malformation and mental retardation. The proteins encoded by BBS gene family members are structurally diverse. The similar phenotypes exhibited by mutations in BBS gene family members are likely due to the protein's shared roles in cilia formation and function. Many BBS proteins localize to the basal bodies, ciliary axonemes, and pericentriolar regions of cells. BBS proteins may also be involved in intracellular trafficking via microtubule-related transport.

Molekulargewicht: 58 kDa (MW of target protein)

Pathways: Hedgehog Signalweg, Tube Formation, Maintenance of Protein Location