EIF4A1 Antikörper (Middle Region)

Produktnummer ABIN633087

Produktdetails anti-EIF4A1 Antikörper

Target: EIF4A1 (Eukaryotic Translation Initiation Factor 4A1 (EIF4A1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF4A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EIF4 A1 antibody was raised against the middle region of EIF4 1

Aufreinigung: Affinity purified

Immunogen: EIF4 A1 antibody was raised using the middle region of EIF4 1 corresponding to a region with amino acids TMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF4A1 Blocking Peptide, catalog no. 33R-9207, is also available for use as a blocking control in assays to test for specificity of this EIF4A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF4A1

Target: EIF4A1 (Eukaryotic Translation Initiation Factor 4A1 (EIF4A1))

Andere Bezeichnung: EIF4A1 (EIF4A1 Produkte)

Synonyme: DDX2A antikoerper, EIF-4A antikoerper, EIF4A antikoerper, eIF-4A-I antikoerper, eIF4A-I antikoerper, BM-010 antikoerper, Ddx2a antikoerper, Eif4 antikoerper, ddx2a antikoerper, eif-4a antikoerper, eif4a antikoerper, eif4a1 antikoerper, fb49a04 antikoerper, im:7143023 antikoerper, wu:fb20a10 antikoerper, wu:fb49a04 antikoerper, wu:fc76a02 antikoerper, wu:fc96c01 antikoerper, wu:fd15g03 antikoerper, eukaryotic translation initiation factor 4A1 antikoerper, eukaryotic translation initiation factor 4A1 L homeolog antikoerper, eukaryotic initiation factor 4A-I antikoerper, eukaryotic translation initiation factor 4A1A antikoerper, EIF4A1 antikoerper, Eif4a1 antikoerper, eif4a1.L antikoerper, eif4a1 antikoerper, LOC695050 antikoerper, eif4a1a antikoerper

Hintergrund: EIF4A1 is an ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.

Molekulargewicht: 46 kDa (MW of target protein)