TUBG2 Antikörper (Middle Region)

Produktnummer ABIN633086

Produktdetails anti-TUBG2 Antikörper

Target: TUBG2 (Tubulin, gamma 2 (TUBG2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TUBG2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Gamma Tubulin 2 antibody was raised against the middle region of TUBG2

Aufreinigung: Affinity purified

Immunogen: Gamma Tubulin 2 antibody was raised using the middle region of TUBG2 corresponding to a region with amino acids FDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Gamma Tubulin 2 Blocking Peptide, catalog no. 33R-2866, is also available for use as a blocking control in assays to test for specificity of this Gamma Tubulin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBG2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TUBG2

Target: TUBG2 (Tubulin, gamma 2 (TUBG2))

Abstract: TUBG2 Produkte

Synonyme: ARABIDOPSIS THALIANA GAMMA-TUBULIN COMPLEX PROTEIN 2 antikoerper, ATGCP2 antikoerper, GAMMA-TUBULIN 2 antikoerper, MJJ3.10 antikoerper, MJJ3_10 antikoerper, TUBG2 antikoerper, gamma-tubulin complex protein 2 antikoerper, AI504772 antikoerper, Tubgl antikoerper, gamma-tubulin antikoerper, gamma-tubulin complex protein 2 antikoerper, tubulin gamma 2 antikoerper, tubulin, gamma 2 antikoerper, TUBG2 antikoerper, GCP2 antikoerper, Tubg2 antikoerper

Hintergrund: Tubulin is the major constituent of microtubules. Gamma tubulin is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome, suggesting that it is involved in the minus-end nucleation of microtubule assembly.

Molekulargewicht: 51 kDa (MW of target protein)

Pathways: Microtubule Dynamics, M Phase