FZR1 Antikörper

Produktnummer ABIN633045

Produktdetails anti-FZR1 Antikörper

Target: FZR1 (Fizzy/cell Division Cycle 20 Related 1 (FZR1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FZR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: FZR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FZR1 Blocking Peptide, catalog no. 33R-8839, is also available for use as a blocking control in assays to test for specificity of this FZR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FZR1

Target: FZR1 (Fizzy/cell Division Cycle 20 Related 1 (FZR1))

Andere Bezeichnung: FZR1 (FZR1 Produkte)

Synonyme: CDH1-C antikoerper, FYR antikoerper, FZR antikoerper, CDH1 antikoerper, fzr1 antikoerper, CDC20C antikoerper, FZR2 antikoerper, HCDH antikoerper, HCDH1 antikoerper, AW108046 antikoerper, Cdh1 antikoerper, Fyr antikoerper, zgc:55450 antikoerper, fizzy and cell division cycle 20 related 1 antikoerper, fizzy/cell division cycle 20 related 1 antikoerper, fizzy-related protein homolog antikoerper, fizzy/cell division cycle 20 related 1 (Drosophila) antikoerper, fizzy/cell division cycle 20 related 1a antikoerper, Fzr1 antikoerper, CDH1-C antikoerper, FZR1 antikoerper, LOC100027495 antikoerper, LOC100179951 antikoerper, fzr1a antikoerper

Hintergrund: FZR1 is a key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. FZR1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.

Molekulargewicht: 55 kDa (MW of target protein)

Pathways: DNA Replication, Synthesis of DNA