EIF3L Antikörper (N-Term)

Produktnummer ABIN632992

Produktdetails anti-EIF3L Antikörper

Target: EIF3L (Eukaryotic Translation Initiation Factor 3, Subunit L (EIF3L))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF3L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EIF3 EIP antibody was raised against the N terminal of EIF3 IP

Aufreinigung: Affinity purified

Immunogen: EIF3 EIP antibody was raised using the N terminal of EIF3 IP corresponding to a region with amino acids SYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF3EIP Blocking Peptide, catalog no. 33R-8952, is also available for use as a blocking control in assays to test for specificity of this EIF3EIP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 IP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF3L

Target: EIF3L (Eukaryotic Translation Initiation Factor 3, Subunit L (EIF3L))

Andere Bezeichnung: EIF3EIP (EIF3L Produkte)

Synonyme: wu:fb66c05 antikoerper, zgc:64147 antikoerper, EIF3EIP antikoerper, EIF3S11 antikoerper, EIF3S6IP antikoerper, HSPC021 antikoerper, HSPC025 antikoerper, MSTP005 antikoerper, 0610011H21Rik antikoerper, D15N1e antikoerper, Eif3eip antikoerper, Eif3ip antikoerper, Eif3s6ip antikoerper, HSP-66Y antikoerper, PAF67 antikoerper, eif3eip antikoerper, eif3s6ip antikoerper, eukaryotic translation initiation factor 3, subunit 6 interacting protein antikoerper, eukaryotic translation initiation factor 3 subunit L antikoerper, eukaryotic translation initiation factor 3, subunit L antikoerper, eukaryotic translation initiation factor 3 subunit L L homeolog antikoerper, eif3s6ip antikoerper, EIF3L antikoerper, Eif3l antikoerper, eif3l.L antikoerper

Hintergrund: EIF3EIP belongs to the EIF3EIP family. It interacts with EIF3E. EIF3EIP interacts with Int-6 and is associated with eukaryotic translation initiation factor 3.

Molekulargewicht: 67 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization