CDC27 Antikörper
-
- Target Alle CDC27 Antikörper anzeigen
- CDC27 (Cell Division Cycle 27 Homolog (S. Cerevisiae) (CDC27))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CDC27 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CDC27 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKIST
- Top Product
- Discover our top product CDC27 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CDC27 Blocking Peptide, catalog no. 33R-4514, is also available for use as a blocking control in assays to test for specificity of this CDC27 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC27 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDC27 (Cell Division Cycle 27 Homolog (S. Cerevisiae) (CDC27))
- Andere Bezeichnung
- CDC27 (CDC27 Produkte)
- Synonyme
- ANAPC3 antikoerper, APC3 antikoerper, CDC27Hs antikoerper, D0S1430E antikoerper, D17S978E antikoerper, HNUC antikoerper, NUC2 antikoerper, wu:fb54g06 antikoerper, wu:fc88c12 antikoerper, AI452358 antikoerper, BC023187 antikoerper, CDC27 antikoerper, NV10210 antikoerper, cell division cycle 27 antikoerper, cell division cycle 27 S homeolog antikoerper, cell division cycle protein 27 homolog antikoerper, anaphase-promoting complex subunit Apc3 antikoerper, CDC27 antikoerper, cdc27 antikoerper, Cdc27 antikoerper, cdc27.S antikoerper, LOC100123129 antikoerper, nuc2 antikoerper
- Hintergrund
- The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae protein Cdc27, and the gene product of Schizosaccharomyces pombe nuc 2. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells.
- Molekulargewicht
- 92 kDa (MW of target protein)
-