CDC27 Antikörper

Produktnummer ABIN632660

Produktdetails anti-CDC27 Antikörper

Target: CDC27 (Cell Division Cycle 27 Homolog (S. Cerevisiae) (CDC27))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDC27 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CDC27 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKIST

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDC27 Blocking Peptide, catalog no. 33R-4514, is also available for use as a blocking control in assays to test for specificity of this CDC27 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC27 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDC27

Target: CDC27 (Cell Division Cycle 27 Homolog (S. Cerevisiae) (CDC27))

Andere Bezeichnung: CDC27 (CDC27 Produkte)

Synonyme: ANAPC3 antikoerper, APC3 antikoerper, CDC27Hs antikoerper, D0S1430E antikoerper, D17S978E antikoerper, HNUC antikoerper, NUC2 antikoerper, wu:fb54g06 antikoerper, wu:fc88c12 antikoerper, AI452358 antikoerper, BC023187 antikoerper, CDC27 antikoerper, NV10210 antikoerper, cell division cycle 27 antikoerper, cell division cycle 27 S homeolog antikoerper, cell division cycle protein 27 homolog antikoerper, anaphase-promoting complex subunit Apc3 antikoerper, CDC27 antikoerper, cdc27 antikoerper, Cdc27 antikoerper, cdc27.S antikoerper, LOC100123129 antikoerper, nuc2 antikoerper

Hintergrund: The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae protein Cdc27, and the gene product of Schizosaccharomyces pombe nuc 2. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells.

Molekulargewicht: 92 kDa (MW of target protein)