CRY2 Antikörper
-
- Target Alle CRY2 Antikörper anzeigen
- CRY2 (Cryptochrome 2 (Photolyase-Like) (CRY2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CRY2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Cryptochrome 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDE
- Top Product
- Discover our top product CRY2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Cryptochrome 2 Blocking Peptide, catalog no. 33R-3945, is also available for use as a blocking control in assays to test for specificity of this Cryptochrome 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRY2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CRY2 (Cryptochrome 2 (Photolyase-Like) (CRY2))
- Andere Bezeichnung
- Cryptochrome 2 (CRY2 Produkte)
- Synonyme
- Cry2 antikoerper, Cry antikoerper, GB10211 antikoerper, CRY2 antikoerper, AT-PHH1 antikoerper, ATCRY2 antikoerper, CRYPTOCHROME 2 APOPROTEIN antikoerper, F19P19.14 antikoerper, F19P19_14 antikoerper, FHA antikoerper, PHH1 antikoerper, cryptochrome 2 antikoerper, HCRY2 antikoerper, PHLL2 antikoerper, AV006279 antikoerper, D130054K12Rik antikoerper, gCry2 antikoerper, cryptochrome circadian regulator 2 antikoerper, cryptochrome 2 antikoerper, cryptochrome Cry2 antikoerper, cryptochrome circadian clock 2 antikoerper, cryptochrome 2 (photolyase-like) antikoerper, CRY2 antikoerper, Cry2 antikoerper, cry2 antikoerper, LOC100502533 antikoerper
- Hintergrund
- CRY2 is a blue light-dependent regulator of the circadian feedback loop.CRY2 inhibits CLOCK|NPAS2-ARNTL E box-mediated transcription. CRY2 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity.
- Molekulargewicht
- 67 kDa (MW of target protein)
- Pathways
- Response to Water Deprivation, Protein targeting to Nucleus
-